Description

  • Product name

    Recombinant Human S6K1 protein (His tag)
    See all S6K1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab229359 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL NESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKG GYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLA EISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVT HTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTL SESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVK FSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQ PNSGPYKKQAFPMISKRPEHLRMNLLEHHHHHH
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      1 to 525
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_003152.

Specifications

Our Abpromise guarantee covers the use of ab229359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 2.9% Sodium chloride, 0.03% DTT, 0.002% PMSF, 30% Glycerol

General Info

  • Alternative names

    • 70 kDa ribosomal protein S6 kinase 1
    • KS6B1_HUMAN
    • p70 alpha
    • P70 beta 1
    • p70 ribosomal S6 kinase alpha
    • p70 ribosomal S6 kinase beta 1
    • P70 S6 Kinase
    • p70 S6 kinase alpha
    • p70 S6 kinase, alpha 1
    • p70 S6 kinase, alpha 2
    • p70 S6K
    • p70 S6K-alpha
    • p70 S6KA
    • p70(S6K) alpha
    • p70(S6K)-alpha
    • p70-alpha
    • p70-S6K
    • p70-S6K 1
    • P70S6K
    • P70S6K1
    • p70S6Kb
    • PS6K
    • Ribosomal protein S6 kinase 70kDa polypeptide 1
    • Ribosomal protein S6 kinase beta 1
    • Ribosomal protein S6 kinase beta-1
    • Ribosomal protein S6 kinase I
    • RPS6KB1
    • S6K
    • S6K-beta-1
    • S6K1
    • Serine/threonine kinase 14 alpha
    • Serine/threonine-protein kinase 14A
    • STK14A
    see all
  • Function

    Acts to integrate nutrient and growth factor signals in regulation of protein synthesis, cell proliferation, cell growth, cell cycle progression and cell survival. Downstream effector of the mTOR signaling pathway. Phosphorylates specifically ribosomal protein S6 in response to insulin or several classes of mitogens. During translation initiation, the inactive form associatess with the eIF-3 complex under conditions of nutrient depletion. Mitogenic stimulation leads to phosphorylation and dissociation from the eIF-3 complex and the free activated form can phosphorylate other translational targets including EIF4B. Promotes protein synthesis by phosphorylating PDCD4 at 'Ser-67' and targeting it for degradation. Phosphorylates RICTOR leading to regulation of mammalian target of rapamycin complex 2 (mTORC2) signaling; probably phosphorylates RICTOR at 'Thr-1135'. Phosphorylates IRS1 at multiple serine residues coupled with insulin resistance; probably phosphorylates IRS1 at 'Ser-270'. Required for TNF-alpha induced IRS-1 degradation. Phosphorylates EEF2K in response to IGF1 and inhibits EEF2K activity. Phosphorylates BAD at 'Ser-99' in response to IGF1 leading to BAD inactivation and inhibition of BAD-induced apoptosis. Phosphorylates mitochondrial RMP leading to dissociation of a RMP:PPP1CC complex; probably phosphorylates RMP at 'Ser-99'. The free mitochondrial PPP1CC can dephosphorylate RPS6KB1 at Thr-412 which is proposed to be a negative feed back mechanism for the RPS6KB1 antiapoptotic function. Phosphorylates GSK3B at 'Ser-9' under conditions leading to loss of the TSC1-TSC2 complex. Phosphorylates POLDIP3.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Domain

    The autoinhibitory domain is believed to block phosphorylation within the AGC-kinase C-terminal domain and the activation loop.
    The TOS (TOR signaling) motif is essential for activation by mTORC1.
  • Post-translational
    modifications

    Phosphorylation at Thr-412 is regulated by mTORC1. The phosphorylation at this site is maintained by an agonist-dependent autophosphorylation mechanism.
  • Cellular localization

    Cytoplasm; Nucleus. Cytoplasm and Cell junction > synapse > synaptosome. Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229359.

    MW 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab229359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up