Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNS NRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLE DSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
    • Molecular weight

      40 kDa including tags
    • Amino acids

      1 to 130

Specifications

Our Abpromise guarantee covers the use of ab132465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Reduced Glutathione

General Info

  • Alternative names

    • Amyloid A, serum, 4
    • C SAA
    • C-SAA
    • Constitutively expressed serum amyloid A protein
    • CSAA
    • SAA 4
    • Saa4
    • SAA4 protein
    • SAA4_HUMAN
    • Serum amyloid A 4 protein
    • Serum amyloid A-4 protein
    • Serum amyloid A4 constitutive
    see all
  • Function

    Major acute phase reactant. Apolipoprotein of the HDL complex.
  • Tissue specificity

    Expressed by the liver; secreted in plasma.
  • Sequence similarities

    Belongs to the SAA family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132465 on a 12.5% gel stained with Coomassie Blue.

References

ab132465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up