Description

  • Product name

    Recombinant Human SAA4 protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPG GVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDP DRFRPDGLPKKY
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      19 to 130
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.17% Sodium chloride, 20% Glycerol, 0.015% EDTA, 0.24% Tris

    Supplied as a 0.2 µm Ø filtered solution.

General Info

  • Alternative names

    • Amyloid A, serum, 4
    • C SAA
    • C-SAA
    • Constitutively expressed serum amyloid A protein
    • CSAA
    • SAA 4
    • Saa4
    • SAA4 protein
    • SAA4_HUMAN
    • Serum amyloid A 4 protein
    • Serum amyloid A-4 protein
    • Serum amyloid A4 constitutive
    see all
  • Function

    Major acute phase reactant. Apolipoprotein of the HDL complex.
  • Tissue specificity

    Expressed by the liver; secreted in plasma.
  • Sequence similarities

    Belongs to the SAA family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab173023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up