Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE IAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQ NLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNS IKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLD SSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFR TDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA PVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 346

Specifications

Our Abpromise guarantee covers the use of ab140413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    > 95 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Activator of SUMO1
    • AOS1
    • HSPC140
    • Sae1
    • SAE1_HUMAN
    • Sentrin/SUMO activating protein AOS1
    • SUA1
    • SUMO 1 activating enzyme E1 N subunit
    • SUMO 1 activating enzyme subunit 1
    • SUMO-activating enzyme subunit 1
    • Ubiquitin like protein SUMO1 activating enzyme
    • Ubiquitin-like 1-activating enzyme E1A
    • UBL E1A
    • UBLE1A
    see all
  • Function

    The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
  • Tissue specificity

    Expression level increases during S phase and drops in G2 phase (at protein level).
  • Pathway

    Protein modification; protein sumoylation.
  • Sequence similarities

    Belongs to the ubiquitin-activating E1 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab140413.

References

ab140413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up