Overview

  • Product name

    Recombinant Human SAH3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDP EAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRD GGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIGRRSLSRSISQ SSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRRE IEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALG AQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAG KLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGY GEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDI VITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERV RSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIEL YNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK NGPFKPNYYRY
    • Molecular weight

      93 kDa including tags
    • Amino acids

      1 to 611

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adenosylhomocysteinase 3
    • Adenosylhomocysteinase3
    • AdoHcyase
    • AdoHcyase 3
    • AdoHcyase3
    • AHC
    • Ahcyl2
    • FLJ21719
    • Hypothetical protein FLJ27233
    • KIAA0828
    • Putative adenosylhomocysteinase 3
    • S adenosyl L homocysteine hydrolase 3
    • S adenosyl L homycysteine hydrolase
    • S-adenosyl-L-homocysteine hydrolase 3
    • S-adenosylhomocysteine hydrolase-like protein 2
    • SAH 3
    • SAHH3_HUMAN
    see all
  • Pathway

    Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.
  • Sequence similarities

    Belongs to the adenosylhomocysteinase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab132065 at approximately 93.1 kDa.

References

ab132065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up