Description

  • Product name

    Recombinant Human SAHH protein
    See all SAHH proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab99326 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSDKLPYKVADIGLAAWGRKALDIAENEMP GLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILD DGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQ ALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRL KNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYP VGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY RY
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 432
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as S adenosylhomocysteine hydrolase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.40
    Constituents: 20% Glycerol, PBS

General Info

  • Alternative names

    • Adenosylhomocysteinase
    • AdoHcyase
    • ahcY
    • S adenosyl L homocysteine hydrolase
    • S adenosylhomocysteine hydrolase
    • S-adenosyl-L-homocysteine hydrolase
    • SAHH
    • SAHH_HUMAN
    see all
  • Function

    Adenosylhomocysteine is a competitive inhibitor of S-adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
  • Pathway

    Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.
  • Involvement in disease

    Defects in AHCY are the cause of hypermethioninemia with S-adenosylhomocysteine hydrolase deficiency (HMAHCHD) [MIM:613752]. A metabolic disorder characterized by hypermethioninemia associated with failure to thrive, mental and motor retardation, facial dysmorphism with abnormal hair and teeth, and myocardiopathy.
  • Sequence similarities

    Belongs to the adenosylhomocysteinase family.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99326 (3µg).
  • Anti-SAHH antibody (ab56146) at 1 µg/ml + Recombinant Human SAHH protein (ab99326) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 90 seconds

References

This product has been referenced in:

  • Drake KM  et al. A sensitive luminescent assay for the histone methyltransferase NSD1 and other SAM-dependent enzymes. Assay Drug Dev Technol 12:258-71 (2014). Functional Studies . Read more (PubMed: 24927133) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for contacting us.

please find below the information we managed to collect about the S adenosylhomocysteine hydrolase protein:

Regrettably, our protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denaturing agents, so it is possible that it’s bioactive. Also, we do not currently have any references about this product used in enzymatic assay. We will update the on-line datasheet for this product as soon as we receive additional data.

If you want to test this protein for functional assay, I can offer you a discount off a future purchase if you buy ab99326 now, test it in functional assay and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of: 1 free protein or value off next order.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab99326 in functional assay. I will then send a discount code. This code must be issued before purchasing ab99326 so please wait for my reply before ordering.

2. Purchase ab99326 either by phone, fax, or online (https://www.abcam.com).

3. Test it in functional assay.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any protein ordered and the discount code is valid for 4 months after issue.
Please remember that submission of the Abreview is sufficient for the discount code to become active.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab99326 turns out to be unsuitable for functional assay, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: https://www.abcam.com/collaborationdiscount.

Read More

Answer

Gracias por contactarnos.

Espero que no te importe que te conteste en castellano, ya que recientemente hemos inaugurado el Servicio Técnico en español. Si prefirieses seguir contactándonos en ingles, no dudes en comunicármelo.

¿Puedes por favor enviarme el número de pedido de la proteína? ¿En qué condiciones se almacenó? ¿En qué consiste el protocolo llevado a cabo?

No tenemos constancia de esa publicación citando este producto, normalmente todas las publicaciones citando nuestros productos se añaden a la datasheet de los mismos.

Voy a comprobarlo con mis compañeros mientras espero tu respuesta con más detalles.

Muchas gracias por la información.

Read More

Question
Answer

Thank you for contacting Abcam.

We have not tested any of these products for enzymatic activity and so we cannot guarantee that they will have. However, you could take advantage of our testing discount program:

https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount



If there is anything else I can help you with, or if you would like to take advantage of our testing discount program, then please let me know.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up