Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGD IKAILDKLHNLNSNWFPEGSKPFI
    • Amino acids
      172 to 245
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • amylase, salivary, B
    • 1
    • 1 4 alpha D glucan glucanohydrolase
    • 1,4 alpha D glucan glucanohydrolase 2B
    • 1,4-alpha-D-glucan glucanohydrolase 1
    • 4-alpha-D-glucan glucanohydrolase 1
    • Alpha amylase
    • Alpha-amylase 1
    • AMY1
    • AMY1_HUMAN
    • AMY1C
    • AMY2
    • AMY2B
    • AMY3
    • amylase, alpha 1A (salivary)
    • Amylase, alpha 1B (salivary)
    • amylase, alpha 1C (salivary)
    • amylase, salivary, alpha-1A
    • amylase, salivary, alpha-1B
    • amylase, salivary, alpha-1C
    • amylase, salivary, C
    • glycogenase
    • HXA
    • PA
    • Salivary alpha-amylase
    • salivary amylase alpha 1A
    • salivary amylase alpha 1B
    • salivary amylase alpha 1C
    see all
  • Sequence similarities
    Belongs to the glycosyl hydrolase 13 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab157886 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up