Overview

  • Product name
    Recombinant Human Salusin alpha protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKK DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYR
    • Amino acids
      91 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • prosalusin
    • Prosalusin precursor
    • TOR2A
    • TORP1
    • torsin 2A
    • Torsin 2A [Precursor]
    • Torsin family 2 member A
    • Torsin related protein 1
    see all
  • Relevance
    Salusins are multifunctional bioactive peptides discovered by bioinformatics analyses of a full-length cDNA library. Salusin alpha and salusin beta are related peptides of 28 and 20 amino acids that were recently characterized. These peptides are considered to be biosynthesized from preprosalusin, an alternative-splicing product of the torsion dystonia-related gene (TOR2A), after frameshift reading and digestion at dibasic amino acids. Salusin alpha has recently been shown to be involved in atherosclerosis; it potently suppresses acyl-CoA:cholesterol acyltransferase-1 which stores cholesterol ester converted from free cholesterol in macrophages, thereby reducing human macrophage foam cell formation.
  • Cellular localization
    Secreted

Images

  • ab162157 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up