Description

  • Product name

    Recombinant Human SAMSN1 protein
  • Purity

    > 80 % SDS-PAGE.
    ab181918 was purified by using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLKRKPSNVSEKEKHQKPKRSSSFGNF DRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTM KKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMD SLYSGQSSSS GITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIK KGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRR SNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIK ESHLIELNIE NPDDRRRLLS AAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNS DNGKEDLESENLSDMVHKIIITEPSD
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 373
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_071419.

Specifications

Our Abpromise guarantee covers the use of ab181918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names

    • HACS1
    • Hematopoietic adapter containing SH3 and sterile α motif (SAM) domains 1
    • Hematopoietic adapter containing SH3 and sterile alpha motif (SAM) domains 1
    • Hematopoietic adaptor containing SH3 and SAM domains 1
    • Nash1
    • Nuclear localization signals SAM and SH3 domain containing 1
    • SAM and SH3 domain containing 2
    • SAM domain
    • SAM domain containing protein SAMSN 1
    • SAM domain SH3 domain and nuclear localisation signals 1
    • SAM domain SH3 domain and nuclear localization signals 1
    • SAM domain, SH3 domain and nuclear localization signals protein 1
    • SAM domain-containing protein SAMSN-1
    • SAMN1_HUMAN
    • SAMSN 1
    • Samsn1
    • SASH2
    • SH3 domain and nuclear localisation signals 1
    • SH3 domain and nuclear localization signals protein 1
    • SH3 SAM adaptor protein
    • SH3-SAM adaptor protein
    • SH3D6B
    • SLy2
    • Src homology domain 3 (SH3) containing adapter protein SH3 lymphocyte protein 2
    see all
  • Function

    Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation.
  • Tissue specificity

    Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood.
  • Sequence similarities

    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Nucleus. Cytoplasm. Cell projection > ruffle. Shuttles between cytoplasm and nucleus. Colocalizes with the actin cytoskeleton and actin-rich membrane ruffles.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181918 (3µg).

References

ab181918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up