Description

  • Product name

    Recombinant Human SAP102 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAG YGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNG SGPSWWPECTCTNRDWYEQVNGSDGMFKYEEIVLERGNSGLGFSIAGGID NPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAV EALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIP GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKN TSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAV ESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNI VGGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAA ALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSE KRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVT PHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDY YGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPH KFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDN LYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEA LMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQI IEDQSGHYIWVPSPEKL
    • Predicted molecular weight

      117 kDa including tags
    • Amino acids

      1 to 817

Specifications

Our Abpromise guarantee covers the use of ab131896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA291O7.3
    • bA291O7.3 discs large Drosophila homolog 3 neuroendocrine dlg
    • Discs large Drosophila homolog 3
    • Discs large homolog 3
    • Discs large homolog 3 neuroendocrine dlg Drosophila
    • Discs large homolog 3 Drosophila
    • Discs, large homolog 3 (Drosophila)
    • Disks large homolog 3
    • DLG 3
    • Dlg3
    • DLG3_HUMAN
    • KIAA1232
    • mKIAA1232
    • MRX
    • MRX 90
    • MRX90
    • NE Dlg
    • NEDLG
    • Neuroendocrine dlg
    • Neuroendocrine-DLG
    • OTTHUMP00000023475
    • OTTHUMP00000023476
    • OTTHUMP00000023477
    • SAP 102
    • SAP-102
    • SAP102
    • Synapse associated protein 102
    • Synapse-associated protein 102
    • XLMR
    see all
  • Function

    Required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.
  • Involvement in disease

    Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90) [MIM:300189]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131896 stained with Coomassie Blue.

References

ab131896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up