Recombinant Human SAP30L protein (ab164075)

Overview

  • Product name
    Recombinant Human SAP30L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKR VQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSP EHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNI PVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE
    • Amino acids
      1 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11526
    • FLJ23595
    • FLJ36497
    • HCV non- tructural protein 4A transactivated protein 2
    • HCV non-structural protein 4A-transactivated protein 2
    • Histone deacetylase complex subunit SAP30L
    • NS4ATP2
    • SAP30 like
    • sap30l
    • Sin3 associated protein p30 like
    • Sin3 corepressor complex subunit SAP30L
    • Sin3-associated protein p30-like
    • Sin3A associated protein p30-like
    • SP30L_HUMAN
    see all
  • Function
    Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC) to the nucleolus.
  • Tissue specificity
    Expressed in all tissues tested with highest levels in testis.
  • Sequence similarities
    Belongs to the SAP30 family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab164075 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up