Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALI DIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 90

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Discs large homolog 1
    • discs large, Drosophila, homolog of, 1
    • discs, large homolog 1 (Drosophila)
    • Disks large homolog 1
    • dJ1061C18.1.1
    • DKFZp761P0818
    • DKFZp781B0426
    • DLG 1
    • DLG1
    • DLG1_HUMAN
    • DLGH 1
    • DLGH1
    • hDlg
    • Presynaptic protein SAP97
    • SAP 97
    • SAP-97
    • SAP97
    • Synapse associated protein 97
    • Synapse-associated protein 97
    see all
  • Function

    Essential multidomain scaffolding protein required for normal development (By similarity). Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel.
  • Tissue specificity

    Abundantly expressed in atrial myocardium (at protein level). Expressed in lung fibroblasts, cervical epithelial and B-cells (at protein level). Widely expressed, with isoforms displaying different expression profiles.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 1 L27 domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Domain

    The alternatively spliced domain I3 corresponding to amino acids (636-669) of isoform 4 is an EPB41 binding site mediating association to membranes in polarized and non-polarized cells.
    The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2.
    The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization.
  • Post-translational
    modifications

    Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A.
  • Cellular localization

    Membrane. Basolateral cell membrane. Endoplasmic reticulum membrane. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell junction, synapse. Cell membrane, sarcolemma. Colocalizes with EPB41 at regions of intercellular contacts. Basolateral in epithelial cells. May also associate with endoplasmic reticulum membranes. Mainly found in neurons soma, moderately found at postsynaptic densities (By similarity).
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152336 stained with Coomassie Blue.

References

ab152336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up