Overview

  • Product name
    Recombinant Human SAPS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCR QQCMEELVSLITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDE SLLSLLYDFLDHEPPLNPLLASFFSKTIGNLIARKTEQVITFLKKKDKFI SLVLKHIGTSALMDLLLRLVSCVEPAGLRQDVLHWLNEEKVIQRLVELIH PSQDEDRQSNASQTLCDIVRLGRDQGSQLQEALEPDPLLTALESQDCVEQ LLKNMFDGDRTESCLVSGTQVLLTLLETRRVGTEGLVDSFSQGLERSYAV SSSVLHGIEPRLKDFHQLLLNPPKKKAILTTIGVLEEPLGNARLHGARLM AALLHTNTPSINQELCRLNTMDLLLDLFFKYTWNNFLHFQVELCIAAILS HAAREERTEASGSESRVEPPHENGNRSLETPQPAASLPDNTMVTHLFQKC CLVQRILEAWEANDHTQAAGGMRRGNMGHLTRIANAVVQNLERGPVQTHI SEVIRGLPADCRGRWESFVEETLTETNRRNTVDLAFSDYQIQQMTANFVD QFGFNDEEFADQDDNINAPFDRIAEINFNIDADEDSPSAALFEACCSDRI QPFDDDEDEDIWEDSDTRCAARVMARPRFGAPHASESCSKNGPERGGQDG KASLEAHRDAPGAGAPPAPGKKEAPPVEGDSEGAMWTAVFDEPANSTPTA PGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTEC SHAEGSRSQGPEKAFSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGD QKAASAMDAVSRGPGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPK EVTAAPAVAVPPEATVAITTALSKAGPAIPTPAVSSALAVAVPLGPIMAV TAAPAMVATLGTVTKDGKTDAPPEGAALNGPV
    • Amino acids
      1 to 932
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SAPS 2
    • dJ579N16.1
    • KIAA0685
    • PP6R2
    • SAP190
    • SAPS domain family, member 2
    see all
  • Relevance
    SAPS2 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C). Protein phosphatase regulatory subunits, such as SAPS2, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. It is ubiquitously expressed with strongest expression in the testis followed by liver, heart, kidney, brain and placenta. There are two named isoforms.
  • Cellular localization
    Cytoplasm

Images

  • ab160617 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up