Description

  • Product name

    Recombinant Human SBDS protein (His tag)
    See all SBDS proteins and peptides
  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVL QTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERH TQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTK QQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESED YGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      2 to 250
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH65700. Full length mature protein minus initiator methionine.

Specifications

Our Abpromise guarantee covers the use of ab200496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Shwachman Bodian-Diamond syndrome. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 3 months (-70C). Avoid repeated freeze-thaw cycles.

General Info

  • Alternative names

    • 4733401P19Rik
    • AI836084
    • CGI 97
    • CGI-97
    • FLJ10917
    • MGC105922
    • Protein 22A3
    • Ribosome maturation protein SBDS
    • sbds
    • SBDS_HUMAN
    • SDS
    • Shwachman Bodian Diamond syndrome protein
    • Shwachman Bodian Diamond syndrome protein homolog
    • Shwachman Bodian-Diamond syndrome
    • Shwachman-Bodian-Diamond syndrome protein
    • SWDS
    see all
  • Function

    Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in SBDS are the cause of Shwachman-Diamond syndrome (SDS) [MIM:260400]. SDS is an autosomal recessive disorder characterized by pancreatic exocrine insufficiency, hematologic dysfunction, and skeletal abnormalities.
  • Sequence similarities

    Belongs to the SDO1/SBDS family.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Nucleus > nucleoplasm. Cytoplasm > cytoskeleton > spindle. Primarily detected in the cytoplasm, and at low levels in nucleus and nucleolus (PubMed:19602484 and PubMed:17475909). Detected in the nucleolus during G1 and G2 phase of the cell cycle, and diffusely distributed in the nucleus during S phase. Detected at the mitotic spindle. Colocalizes with the microtubule organizing center during interphase.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab200496 stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 30-33 kDa.

References

ab200496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up