Description

  • Product name

    Recombinant human SBK1 protein
  • Biological activity

    The specific activity of ab204137 was determined to be 20 nmol /min/mg.

  • Purity

    > 90 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVT KHYELVRELGKGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSI TNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDIIPPQVGLPEDT VKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRR VGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGN FPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEP ERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGP LKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPP GRTDGRADKSKGQVVLATAIEICV
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      1 to 424
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab204874 (PKI-alpha peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Sbk
    • Sbk1
    • SBK1_HUMAN
    • Serine/threonine-protein kinase SBK1
    • SH3-binding domain kinase 1
    • SH3-binding kinase 1
    see all
  • Function

    May be involved in signal-transduction pathways related to the control of brain development.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • The specific activity of SBK1 (ab204137) was determined to be 17 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab204137
  • SDS PAGE analysis of ab204137
  • Sample Kinase Activity Plot showing ab204137. The specific activity of SBK1 was determined to be 20 nmol /min/mg.

  • SDS-PAGE showing ab204137.

References

ab204137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up