Description

  • Product name

    Recombinant Human SC5DL protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSS FEGKGPLSYVKEMTEGKRSSPSGNGCKNEKLFNGEFTKT
    • Amino acids

      210 to 298
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3beta hydroxysteroid delta5 desaturase
    • C 5 sterol desaturase
    • Delta 5 desaturase like
    • Delta(7) sterol 5 desaturase
    • ERG3
    • Fungal ERG3
    • Lathosterol 5 desaturase
    • Lathosterol oxidase
    • MGC93101
    • S5DES
    • SC5D
    • Sterol C5 desaturase
    • Sterol C5 desaturase (ERG3 delta 5 desaturase homolog, S. cerevisiae) like
    see all
  • Relevance

    SC5DL catalyzes the conversion of lathosterol into 7 dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis.
  • Cellular localization

    Endoplasmic reticulum membrane; Multipass membrane protein

Images

  • ab159475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up