Description

  • Product name

    Recombinant Human SCA10 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRV LDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQN SIRNLDTIG
    • Amino acids

      1 to 109
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab161797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ATXN10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ataxin 10
    • Ataxin-10
    • ATX10_HUMAN
    • Atxn10
    • Brain protein E46 homolog
    • E46L
    • FLJ37990
    • HUMEEP
    • Like mouse brain protein E46
    • OTTHUMP00000197383
    • SCA10
    • Spinocerebellar ataxia 10
    • Spinocerebellar ataxia type 10 protein
    see all
  • Function

    Necessary for the survival of cerebellar neurons (By similarity). Induces neuritogenesis by activating the Ras-MAP kinase pathway (By similarity). May play a role in the maintenance of a critical intracellular glycosylation level and homeostasis.
  • Tissue specificity

    Expressed in the central nervous system.
  • Involvement in disease

    Defects in ATXN10 are the cause of spinocerebellar ataxia type 10 (SCA10) [MIM:603516]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA10 is an autosomal dominant cerebellar ataxia (ADCA).
  • Sequence similarities

    Belongs to the ataxin-10 family.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab161797 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up