Overview

  • Product name

    Recombinant Human SCAMP2/SC2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVP VTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELE RKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICK MLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFL CWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAA LSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQA QEEFSQGIFSSRTFHRAASSAAQGAFQGN
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 329

Associated products

Specifications

Our Abpromise guarantee covers the use of ab133002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as SCAMP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • SCAM2_HUMAN
    • SCAMP2
    • Secretory carrier membrane protein 2
    • Secretory carrier-associated membrane protein 2
  • Function

    Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the SCAMP family.
  • Cellular localization

    Golgi apparatus > trans-Golgi network membrane. Recycling endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab133002 stained with Coomassie Blue.

References

ab133002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up