Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIK KIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAP S
    • Amino acids

      1 to 101
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SCAP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fyn associated phosphoprotein SKAP55 homologue
    • MGC10411
    • MGC33
    • PRAP
    • Pyk2/RAFTK associated protein
    • Pyk2/RAFTK-associated protein
    • RA70
    • Retinoic acid-induced protein 70
    • SAPS
    • SKAP-55HOM
    • SKAP-HOM
    • skap2
    • SKAP2_HUMAN
    • SKAP55 homolog
    • SKAP55R
    • Src associated adaptor protein
    • Src family associated phosphoprotein 2
    • Src family-associated phosphoprotein 2
    • src kinase associated phosphoprotein of 55 related protein
    • Src kinase-associated phosphoprotein 2
    • Src kinase-associated phosphoprotein 55-related protein
    • Src-associated adapter protein with PH and SH3 domains
    see all
  • Function

    May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.
  • Tissue specificity

    Ubiquitously expressed. Present in platelets (at protein level).
  • Sequence similarities

    Belongs to the SKAP family.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain interacts with FYB and PTK2B.
  • Post-translational
    modifications

    Phosphorylated in resting platelets. Phosphorylated by FYN on Tyr-261 upon T-cell activation (Probable). Dephosphorylated on Tyr-75 by PTPN22.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab160269 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up