Bioactive grade

Recombinant human Scavenging Receptor SR-BI protein (Fc Chimera) (ab182680)

Description

  • Product name

    Recombinant human Scavenging Receptor SR-BI protein (Fc Chimera)
  • Biological activity

    Measured by its ability to bind recombinant Human ApoAI in a functional ELISA.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGE KPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESD YIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWG YKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIH LVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRS MKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVS TCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPM NCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYT QLVLMPKVMHY
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      33 to 443
    • Additional sequence information

      Fused with Fc fragment of Human IgG1 at the C-terminus. NP_005496.4. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab182680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    As a result of glycosylation, DTT-reduced Scavenging Receptor SR-BI protein migrates as 110-115 kDa and non-reduced protein migrates as 220-230 kDa.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.6% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 250 µl sterile deionized water to a final concentration of 200 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD36
    • CD36 and LIMPII analogous 1
    • CD36 Antigen like 1
    • CD36 antigen-like 1
    • CD36L1
    • CLA 1
    • CLA-1
    • CLA1
    • Collagen type I receptor
    • HDLQTL6
    • MGC138242
    • SCARB1
    • Scavebger Receptor Class B Member 1
    • Scavenger receptor class B member 1
    • Scavenger Receptor Class B Type 1
    • SCRB1_HUMAN
    • SR BI
    • SR-BI
    • SRB1
    • SRBI
    • Thrombospondin receptor like 1
    • thrombospondin receptor-like 1
    see all
  • Function

    Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the CD36 family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Membrane > caveola. Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.
  • Information by UniProt

Images

  • The purity of ab182680 was determined by DTT-reduced (+) and non-reduced (-) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up