Description

  • Product name

    Recombinant Human SCF protein (Fc Chimera)
    See all SCF proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVV QLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKK SFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGK AKNPPGDSSLHW
    • Predicted molecular weight

      18 kDa
    • Amino acids

      26 to 187
    • Additional sequence information

      Fused to the N-terminus of the Fc region of human IgG1 (NP_003985.2).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab216224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilised from 0.2µm filtered solution.

  • Reconstitution
    Reconstitute 10µg vial in 100µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • C kit ligand
    • C-kit ligand
    • Ckit ligand
    • DCUA
    • DFNA69
    • DKFZp686F2250
    • familial progressive hyperpigmentation 2
    • FPH2
    • FPHH
    • KIT ligand
    • Kitl
    • KITLG
    • KL 1
    • KL1
    • Mast cell growth factor
    • MGF
    • MGF stem cell factor
    • SCF
    • SCF_HUMAN
    • SF
    • SHEP7
    • sKITLG
    • Soluble KIT ligand
    • Steel factor
    • steel, mouse, homolog of
    • Stem cell factor
    • Stem cell factor precursor
    see all
  • Function

    Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
  • Involvement in disease

    Hyperpigmentation with or without hypopigmentation, familial progressive
    Deafness, congenital, unilateral or asymmetric
  • Sequence similarities

    Belongs to the SCF family.
  • Developmental stage

    Acts in the early stages of hematopoiesis.
  • Post-translational
    modifications

    A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain.
    Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97.
    A soluble form exists as a cleavage product of the extracellular domain.
  • Cellular localization

    Secreted; Cell membrane and Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, filopodium.
  • Information by UniProt

References

ab216224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up