Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRAS GQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEA QVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANL AAIIERLQEKERHAAEVRRNKELQVELSG
    • Molecular weight

      45 kDa including tags
    • Amino acids

      1 to 179

Specifications

Our Abpromise guarantee covers the use of ab132223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Neuron specific growth associated protein
    • Neuronal growth associated protein
    • Neuronal growth associated protein (silencer element)
    • Protein SCG10
    • SCG 10
    • SCG10
    • SCG10 protein
    • SCGN 10
    • SCGN10
    • SGC 10
    • SGC10
    • Stathmin 2
    • Stathmin like 2
    • Stathmin-2
    • STMN 2
    • STMN2
    • STMN2_HUMAN
    • Superior cervical ganglia neural specific 10
    • Superior cervical ganglion 10 protein
    • Superior cervical ganglion-10 protein
    • Superiorcervical ganglia neural specific 10
    see all
  • Function

    Is a key regulator of neurite extension through regulation of microtubule instabilily.
  • Tissue specificity

    Neuron specific.
  • Sequence similarities

    Belongs to the stathmin family.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Cytoplasm. Cytoplasm > perinuclear region. Cell projection > growth cone. Membrane. Cell projection > axon. Associated with punctate structures in the perinuclear cytoplasm, axons, and growth cones of developing neurons. SCG10 exists in both soluble and membrane-bound forms.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132223 stained with Coomassie Blue.

References

ab132223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up