Overview

  • Product name
    Recombinant Human SCGB1D1 protein (BSA and azide free)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAY EKRVLITKTLGKIAEKCDR
    • Molecular weight
      9 kDa including tags
    • Amino acids
      22 to 90
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab175467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 95 % Densitometry.
    ab175467 is purifed using Ni-NTA chromatography.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml.

General Info

  • Alternative names
    • LIPA
    • LIPHA
    • lipophilin A (uteroglobin family member)
    • Lipophilin-A
    • LPNA
    • prostatein-like lipophilin A
    • secretoglobin, family 1D, member 1
    see all
  • Cellular localization
    Secreted

Images

  • 14% SDS-PAGE analysis of ab175467

    Lane 1: reduced and boiled sample (2.5 μg)

    Lane 2: non-reduced and non-boiled sample (2.5 μg)

References

ab175467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up