Overview

  • Product name
    Recombinant Human SCGB3A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANP LGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGAL TVFG
    • Amino acids
      1 to 104
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytokine high in normal 1
    • Cytokine HIN-1
    • Cytokine HIN1
    • High in normal 1
    • HIN 1
    • HIN1
    • LU105
    • MGC87867
    • Pneumo secretory protein 2
    • PNSP 2
    • PnSP-2
    • PNSP2
    • Scgb3a1
    • Secretoglobin family 3A member 1
    • Secretoglobin family 3A member 1 precursor
    • Secretoglobin, family 3A, member 1
    • SG3A1_HUMAN
    • UGRP2
    • Uteroglobin related protein 2
    • Uteroglobin-related protein 2
    see all
  • Function
    Potential growth inhibitory cytokine.
  • Tissue specificity
    Highly expressed in breast tissues. Absent in breast cancer cell lines.
  • Sequence similarities
    Belongs to the secretoglobin family. UGRP subfamily.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164903 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up