Description

  • Product name

    Recombinant Human SCGF protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.
    ab198771 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEERE REALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATP TPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQG LRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSR DFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGV HDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGT LENCVAQASDDGSWWDHDCQRRLYYVCEFPF
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      22 to 323
    • Additional sequence information

      This is the full length mature protein without the signal peptide, expressed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab198771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 3
    • C type lectin domain family 11 member A
    • C type lectin superfamily member 3
    • C-type lectin domain family 11 member A
    • C-type lectin superfamily member 3
    • CLC11_HUMAN
    • CLEC11A
    • CLECSF3
    • LSLCL
    • Lymphocyte secreted C type lectin
    • Lymphocyte secreted C-type lectin
    • lymphocyte secreted long form of C type lectin
    • p47
    • Stem cell growth factor
    • stem cell growth factor lymphocyte secreted C type lectin
    see all
  • Function

    Stimulates the proliferation and differentiation of hematopoietic precursor cells from various lineages, including erythrocytes, lymphocytes, granulocytes and macrophages. Acts synergistically with other cytokines, including IL-3, GCSF, GMCSF and FLT3 ligand. Suppresses SCF-stimulated erythrocyte proliferation.
  • Tissue specificity

    Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    In the bone marrow, expression is limited to immature neutrophils. Expression was not detected in circulating mature neutrophils.
  • Post-translational
    modifications

    O-glycosylated. Probably sulfated on the O-glycans.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt

References

ab198771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up