Description

  • Product name

    Recombinant Human SCGN/Secretagogin protein (His tag)
    See all SCGN/Secretagogin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTD DTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRE NPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLE EYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRD FEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLR HCDVNKDGKIQKSELALCLGLKINP
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      2 to 276
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH00336).

Specifications

Our Abpromise guarantee covers the use of ab221344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as SCGN

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Calbindin like
    • CALBL
    • DJ501N12.8
    • OTTHUMP00000016124
    • Scgn
    • SECRET
    • Secretagogin
    • Secretagogin EF hand calcium binding protein
    • SEGN
    • SEGN_HUMAN
    • Setagin
    see all
  • Tissue specificity

    Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons.
  • Sequence similarities

    Contains 6 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Cytoplasmic vesicle > secretory vesicle membrane. Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity). Detectable in human serum after ischemic neuronal damage.
  • Information by UniProt

Images

  • SDS-PAGE (DTT reduced) analysis of ab221344 followed by staining overnight with Coomassie Blue.  DTT-reduced Protein migrates as 33 kDa in SDS-PAGE.

References

ab221344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up