Overview

  • Product name

    Recombinant Human SCHIP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MERSGQRVTTWDCDQGKHSDSDYREDGMDLGSDAGSSSSSSRASSQSNST KVTPCSECKSSSSPGGSLDLVSALEDYEEPFPVYQKKVIDEWAPEEDGEE EEEEDERDQRGYRDDRSPAREPGDVSARTRSGGGGGRSATTAMPPPVPNG NLHQHDPQDLRHNGNVVVAGRPSCSRGRRAIQKPQPAGGRRSGRGPAAGG LCLQPPDGGTCVPEEPPVPPMDWEALEKHLAGLQFREQEVRNQGQARTNS TSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQ ICFVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESES LDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPH MPHISECLMKRSLKPTDLRDMTIGQLQVIVNDLHSQIESLNEELVQLLLI RDELHTEQDAMLVDIEDLTRHAESQQKHMAEKMPAK
    • Amino acids

      1 to 486
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ39160
    • SCHI1_HUMAN
    • SCHIP 1
    • SCHIP-1
    • Schip1
    • schwannomin interacting protein 1
    • Schwannomin-interacting protein 1
    see all
  • Relevance

    Tissue specificity: Isoform 5 and isoform 6 are highly expressed in the brain. Both isoforms derive from naturally occurring readthrough transcripts which produce IQCJ-SCHIP1 fusion proteins.
  • Cellular localization

    Partially colocalizes with NF2 beneath the cytoplasmic membrane.

Images

  • ab162296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up