Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEE DPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHN TYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTD PLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRL KQGKCFEN
    • Amino acids

      1 to 208
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gm1792
    • Gm47
    • OTTHUMP00000022996
    • OTTHUMP00000025692
    • RP3-389A20.1
    • SCML1
    • SCML1_HUMAN
    • Sex comb on midleg (Drosophila) like 1
    • Sex comb on midleg like 1
    • Sex comb on midleg like 1 (Drosophila)
    • Sex comb on midleg like protein 1
    • Sex comb on midleg-like protein 1
    • Vsex comb on midleg like 1
    see all
  • Function

    Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation.
  • Tissue specificity

    Ubiquitous. Expressed in fetal and adult tissues.
  • Sequence similarities

    Belongs to the SCM family.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159477 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up