Description

  • Product name

    Recombinant Human SCML1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab198655 was expressed in E.coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEFMSNSSSEIDVQEPNIVSDASCN TEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSLWTN HKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNS PSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDG ATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGS ITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL LKHLGVKLGTAVKLCYYIDRLKQGKCFEN
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      2 to 302
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      cDNA was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (31aa) fusion at its N-terminal (NP_006737.2).

Specifications

Our Abpromise guarantee covers the use of ab198655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • Gm1792
    • Gm47
    • OTTHUMP00000022996
    • OTTHUMP00000025692
    • RP3-389A20.1
    • SCML1
    • SCML1_HUMAN
    • Sex comb on midleg (Drosophila) like 1
    • Sex comb on midleg like 1
    • Sex comb on midleg like 1 (Drosophila)
    • Sex comb on midleg like protein 1
    • Sex comb on midleg-like protein 1
    • Vsex comb on midleg like 1
    see all
  • Function

    Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation.
  • Tissue specificity

    Ubiquitous. Expressed in fetal and adult tissues.
  • Sequence similarities

    Belongs to the SCM family.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab198655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up