Description

  • Product name

    Recombinant Human Scn2b protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPC TFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVE FSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEE PPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 215

Specifications

Our Abpromise guarantee covers the use of ab114773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Neuronal voltage gated sodium channel beta 2 subunit
    • Scn 2b
    • Scn2b
    • SCN2B_HUMAN
    • Sodium channel beta 2 subunit
    • Sodium channel subunit beta 2
    • Sodium channel subunit beta-2
    • Sodium channel voltage gated type II beta
    • Sodium channel voltage gated type II beta polypeptide
    see all
  • Function

    Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier.
  • Tissue specificity

    Brain specific.
  • Sequence similarities

    Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab114773 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up