Description

  • Product name

    Recombinant Human SCN3B protein (His tag)
    See all SCN3B proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222957 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGG KDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYT CNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEHHHHHH
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      23 to 159
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_060870).

Specifications

Our Abpromise guarantee covers the use of ab222957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • 1110001K16Rik
    • 4833414B02Rik
    • HSA243396
    • KIAA1158
    • MGC136997
    • MGC80155
    • Scn3b
    • SCN3B_HUMAN
    • SCNB3
    • Sodium channel subunit beta-3
    • Sodium channel, beta 3 subunit
    • sodium channel, voltage-gated, type III, beta
    see all
  • Function

    Modulates channel gating kinetics. Causes unique persistent sodium currents. Inactivates the sodium channel opening more slowly than the subunit beta-1. Its association with neurofascin may target the sodium channels to the nodes of Ranvier of developing axons and retain these channels at the nodes in mature myelinated axons.
  • Involvement in disease

    Defects in SCN3B are the cause of Brugada syndrome type 7 (BRGDA7) [MIM:613120]. A tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset.
  • Sequence similarities

    Belongs to the sodium channel auxiliary subunit SCN3B (TC 8.A.17) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222957.

    MWt 18-28 kDa (SDS-PAGE under reducing conditions) .

References

ab222957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up