Description

  • Product name

    Recombinant Human SCNN1B protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKA MWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNA SPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPL VLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNR TQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACL FGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDK LQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCN CGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCND TQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQ EFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWI TIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      1 to 640

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amiloride sensitive sodium channel subunit beta
    • Amiloride-sensitive sodium channel subunit beta
    • Beta NaCH
    • Beta-ENaC
    • Beta-NaCH
    • ENaC beta
    • ENaCB
    • Epithelial Na(+) channel subunit beta
    • Epithelial Na+ channel beta subunit
    • Epithelial Na+ channel subunit beta
    • Epithelial sodium channel beta 2 subunit
    • Epithelial sodium channel beta 3 subunit
    • Nonvoltage gated sodium channel 1 beta subunit
    • Nonvoltage gated sodium channel 1 subunit beta
    • Nonvoltage-gated sodium channel 1 subunit beta
    • SCNEB
    • SCNN 1B
    • SCNN1B
    • SCNNB_HUMAN
    • Sodium channel nonvoltage gated 1 beta
    • Sodium channel nonvoltage gated 1 beta (Liddle syndrome)
    see all
  • Function

    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Involvement in disease

    Pseudohypoaldosteronism 1, autosomal recessive
    Liddle syndrome
    Bronchiectasis with or without elevated sweat chloride 1
  • Sequence similarities

    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues.
  • Cellular localization

    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt

Images

  • ab132248 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up