Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGK QPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ
    • Amino acids

      101 to 200
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as epithelial Sodium Channel gamma

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amiloride sensitive epithelial sodium channel gamma subunit
    • Amiloride sensitive sodium channel subunit gamma
    • Amiloride-sensitive sodium channel subunit gamma
    • BESC3
    • ENaC gamma subunit
    • ENaCG
    • ENaCgamma
    • Epithelial Na(+) channel subunit gamma
    • Epithelial Na+ channel subunit gamma
    • Gamma ENaC
    • Gamma NaCH
    • Gamma-ENaC
    • Gamma-NaCH
    • Nonvoltage gated sodium channel 1 subunit gamma
    • Nonvoltage-gated sodium channel 1 subunit gamma
    • PHA 1
    • PHA1
    • SCNEG
    • SCNN 1G
    • SCNN1G
    • SCNNG_HUMAN
    • Sodium channel epithelial 1 gamma subunit
    • Sodium channel non voltage gated 1 gamma subunit
    • Sodium channel nonvoltage gated 1 gamma
    see all
  • Function

    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Involvement in disease

    Defects in SCNN1G are a cause of Liddle syndrome (LIDDS) [MIM:177200]. It is an autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel.
    Defects in SCNN1G are the cause of bronchiectasis with or without elevated sweat chloride type 3 (BESC3) [MIM:613071]. A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases.
  • Sequence similarities

    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1G subfamily.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues.
    Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation.
  • Cellular localization

    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt

Images

  • ab159483 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up