Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLG EEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDV SPVMQFSS
    • Amino acids
      553 to 660
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ezrin binding protein PACE 1
    • Ezrin-binding protein PACE-1
    • PACE 1
    • PACE1
    • PACE1_HUMAN
    • Protein associating with the carboxyl terminal domain of ezrin
    • Protein-associating with the carboxyl-terminal domain of ezrin
    • SCY1 like 3
    • SCY1 like 3 (S. cerevisiae)
    • SCY1 like protein 3
    • SCY1 like pseudokinase 3
    • SCY1-like protein 3
    • SCYL 3
    • SCYL3
    see all
  • Function
    May play a role in regulating cell adhesion/migration complexes in migrating cells.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 4 HEAT repeats.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications
    May be myristoylated; myristoylation may target it to Golgi compartment.
    Phosphorylated.
  • Cellular localization
    Cytoplasm. Golgi apparatus. Cell projection > lamellipodium. Colocalized with EZR/VIL2, actin and CD44 in lamellipodia.
  • Information by UniProt

Images

  • ab163502 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up