Overview

  • Product name

    Recombinant Human SDCCAG8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNL SFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEVSPSRRRKMS PLRSLEHEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKI QVVVLENEGLQQQLKSQRQEETLREQTLLDASGNMHNSWITTGEDSGVGE TSKRPFSHDNADFGKAASAGEQLELEKLKLTYEEKCEIEESQLKFLRNDL AEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNV HMQTIERLVKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEA NFEKTKHPSQ
    • Molecular weight

      67 kDa including tags
    • Amino acids

      1 to 360

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Antigen NY CO 8
    • Antigen NY-CO-8
    • BBS16
    • CCCAP
    • CCCAP SLSN7
    • Centrosomal colon cancer autoantigen protein
    • hCCCAP
    • HSPC085
    • NPHP10
    • NPHP10 gene
    • NY-CO-8
    • Sdccag8
    • SDCG8_HUMAN
    • Serologically defined colon cancer antigen 8
    • Serologically defined colon cancer antigen 8 homolog
    • SLSN7
    • SLSN7 gene
    see all
  • Function

    Plays a role in the establishment of cell polarity and epithelial lumen formation (By similarity). May play a role in ciliogenesis.
  • Tissue specificity

    Expressed in thymus, prostate, testis, ovary, small intestine, colon, mucosa, colon and renal cancer tumors.
  • Involvement in disease

    Senior-Loken syndrome 7 (SLSN7) [MIM:613615]: A renal-retinal disorder characterized by progressive wasting of the filtering unit of the kidney (nephronophthisis), with or without medullary cystic renal disease, and progressive eye disease. Typically this disorder becomes apparent during the first year of life. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Cellular localization

    Cytoplasm and Cytoplasm > cytoskeleton > centrosome > centriole. Cell junction. Located at the distal ends of both centrioles and colocalizes to centrosomes throughout the cell cycle.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132722 stained with Coomassie Blue.

References

ab132722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up