For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-sdf1-protein-active-ab259416.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Alpha Chemokines (CXC)
Share by email
Premium bioactive grade

Recombinant human SDF1 protein (Active) (ab259416)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human SDF1 protein (Active) (ab259416)
  • SDS-PAGE - Recombinant human SDF1 protein (Active) (ab259416)
  • HPLC - Recombinant human SDF1 protein (Active) (ab259416)
  • Mass Spectrometry - Recombinant human SDF1 protein (Active) (ab259416)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: >= 95% SDS-PAGE
  • Endotoxin level: <= 0.005 Eu/µg
  • Active: Yes
  • Suitable for: Functional Studies, Cell Culture, MS, HPLC, SDS-PAGE

You may also be interested in

ELISA
Product image
Human SDF1 alpha ELISA Kit (ab100637)
Biochemical
Product image
AMD 3465 hexahydrobromide, CXCR4 antagonist (ab120809)
Primary
Product image
Anti-Dnmt1 antibody [EPR18453] (ab188453)

View more associated products

Description

  • Product name

    Recombinant human SDF1 protein (Active)
    See all SDF1 proteins and peptides
  • Biological activity

    Fully biologically active determined by the dose dependant migration of THP-1 cells.

    ED50 is ≤ 40 ng/mL, corresponding to a specific activity of 2.50 x 104 units/mg.

  • Purity

    >= 95 % SDS-PAGE.
    >= 95 % HPLC.
  • Endotoxin level

    <=0.005 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P48061
  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Carrier free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Predicted molecular weight

      8 kDa
    • Molecular weight information

      (M-Lys) +/- 0.1 Da (C-terminal Lys loss; calc. mass 7892 Da) KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
    • Amino acids

      22 to 89
    • Additional sequence information

      N-terminal glycine.

Specifications

Our Abpromise guarantee covers the use of ab259416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Cell Culture

    Mass Spectrometry

    HPLC

    SDS-PAGE

  • Form

    Lyophilized
  • Additional notes

    This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

    This protein could lose the C-terminal Lys, but this does not affect performance.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at Room Temperature.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

General Info

  • Alternative names

    • 12-O-tetradecanoylphorbol 13-acetate repressed protein 1
    • AI174028
    • C-X-C motif chemokine 12
    • Chemokine (C-X-C motif) ligand 12
    • Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
    • Chemokine CXC motif ligand 12
    • cxcl12
    • hIRH
    • hSDF-1
    • Intercrine reduced in hepatomas
    • IRH
    • OTTHUMP00000019491
    • PBSF
    • Pre-B cell growth-stimulating factor
    • SCYB12
    • SDF 1
    • SDF-1
    • SDF-1-alpha(3-67)
    • SDF-1a
    • SDF-1b
    • SDF1_HUMAN
    • SDF1A
    • SDF1B
    • Stromal cell-derived factor 1
    • Stromal cell-derived factor 1 delta
    • Stromal cell-derived factor 1 gamma
    • Stromal cell-derived factor 1a
    • Stromal cell-derived factor-1 alpha
    • Thymic lymphoma cell-stimulating factor
    • Tlsf
    • TLSF-a
    • TLSF-b
    • Tlsfa
    • Tlsfb
    • TPAR1
    see all
  • Function

    Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
  • Tissue specificity

    Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Developmental stage

    Isoform Alpha is ubiquitously expressed in fetal tissues. Isoform Beta and isoform Delta have more limited expression patterns, with highest levels detected in fetal spleen and fetal liver, respectively. Isoform Gamma and isoform Theta are weakly detected in fetal kidney.
  • Post-translational
    modifications

    Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P48061 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human SDF1 protein (Active) (ab259416)
    Functional Studies - Recombinant human SDF1 protein (Active) (ab259416)

    Fully biologically active determined by the dose dependant migration of THP-1 cells.

    ED50 is ≤ 40 ng/mL, corresponding to a specific activity of 2.50 x 104 units/mg.

  • SDS-PAGE - Recombinant human SDF1 protein (Active) (ab259416)
    SDS-PAGE - Recombinant human SDF1 protein (Active) (ab259416)

    SDS-PAGE analysis of ab259416.

  • HPLC - Recombinant human SDF1 protein (Active) (ab259416)
    HPLC - Recombinant human SDF1 protein (Active) (ab259416)

    Purity: 98.5%

    The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 µm). 5 µL of purified protein was injected and the gradient run from 80 % water:TFA (99.9:0.1 v/v) and 20 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) to 20 % water:TFA (99.9:0.1 v/v) and 80 % acetonitrile:water:TFA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

  • Mass Spectrometry - Recombinant human SDF1 protein (Active) (ab259416)
    Mass Spectrometry - Recombinant human SDF1 protein (Active) (ab259416)

    (M-Lys) +/- 0.1 Da (C-terminal Lys loss; calc. mass 7892 Da)

    The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 µm, Thermo Scientific). 5 µL of purified protein was injected and the gradient run from 85 % water:FA (99.9:0.1 v/v) and 15 % acetonitrile:FA (90:9.9:0.1 v/v/v) to 55 % water:FA (99.9:0.1 v/v) and 45 % acetonitrile:FA (90:9.9:0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab259416? Please let us know so that we can cite the reference in this datasheet.

ab259416 has been referenced in 1 publication.

  • Chen L  et al. MTSS1 inhibits colorectal cancer metastasis by regulating the CXCR4/CXCL12 signaling axis. Int J Mol Med 47:N/A (2021). PubMed: 33649808

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab259416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.