For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-sdha-protein-tagged-ab226268.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Organelles Mitochondria
Share by email

Recombinant Human SDHA protein (Tagged) (ab226268)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human SDHA protein (Tagged) (ab226268)
  • Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)
  • Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 90% SDS-PAGE
  • Tags: GST tag N-Terminus
  • Suitable for: SDS-PAGE, MS

You may also be interested in

Primary
Product image
Anti-SDHA antibody [EPR9043(B)] (ab137040)
Primary
Product image
Anti-SDHA antibody [2E3GC12FB2AE2] (ab14715)
Primary
Product image
Anti-ATP5A antibody [15H4C4] - Mitochondrial Marker (ab14748)

View more associated products

Description

  • Product name

    Recombinant Human SDHA protein (Tagged)
    See all SDHA proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

    P31040
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKL FPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMT EQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVA DRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGS IHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      44 to 293
    • Tags

      GST tag N-Terminus

Associated products

  • Related Products

    • Anti-GST antibody [EPR4236] (ab111947)
    • Anti-SDHA antibody [EPR9042(B)] (ab139181)

Specifications

Our Abpromise guarantee covers the use of ab226268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • CMD1GG
    • DHSA_HUMAN
    • Flavoprotein subunit of complex II
    • Fp
    • PGL5
    • SDH 2
    • SDH1
    • SDH2
    • SDHA
    • SDHF
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit mitochondrial
    • Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
    • Succinate dehydrogenase complex flavoprotein subunit
    • Succinate dehydrogenase complex flavoprotein subunit A
    • Succinate dehydrogenase complex flavoprotein subunit precursor
    • Succinate dehydrogenase complex subunit A
    • Succinate dehydrogenase complex subunit A flavoprotein
    • Succinate dehydrogenase complex subunit A flavoprotein (Fp)
    see all
  • Function

    Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1.
  • Involvement in disease

    Defects in SDHA are a cause of mitochondrial complex II deficiency (MT-C2D) [MIM:252011]. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations. Clinical features include psychomotor regression in infants, poor growth with lack of speech development, severe spastic quadriplegia, dystonia, progressive leukoencephalopathy, muscle weakness, exercise intolerance, cardiomyopathy. Some patients manifest Leigh syndrome or Kearns-Sayre syndrome.
    Defects in SDHA are a cause of Leigh syndrome (LS) [MIM:256000]. LS is a severe disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions.
    Defects in SDHA are the cause of cardiomyopathy dilated type 1GG (CMD1GG) [MIM:613642]. CMD1GG is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities

    Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily.
  • Cellular localization

    Mitochondrion inner membrane.
  • Target information above from: UniProt accession P31040 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human SDHA protein (Tagged) (ab226268)
    SDS-PAGE - Recombinant Human SDHA protein (Tagged) (ab226268)

    (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226268 with 5% enrichment gel and 15% separation gel.

  • Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)
    Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.

  • Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)
    Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (ab226268)

    Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab226268? Please let us know so that we can cite the reference in this datasheet.

ab226268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab226268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.