Recombinant Human SDHC protein (ab159493)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human SDHC protein
-
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR PLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL ELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQ SGVVVLVLTVLSSMGLAAM
-
Amino acids1 to 169
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159493 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- CYB560
- C560_HUMAN
- CYBL
see all -
FunctionMembrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
-
PathwayCarbohydrate metabolism; tricarboxylic acid cycle.
-
Involvement in diseaseDefects in SDHC are the cause of hereditary paragangliomas type 3 (PGL3) [MIM:605373]; also known as autosomal dominant non-chromaffin paragangliomas type 3. Non-chromaffin paragangliomas are usually benign, neural crest derived tumors of parasympathetic ganglia.
Defects in SDHC are a cause of paraganglioma and gastric stromal sarcoma (PGGSS) [MIM:606864]; also known as Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance. -
Sequence similaritiesBelongs to the cytochrome b560 family.
-
Cellular localizationMitochondrion inner membrane.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human SDHC protein (ab159493)ab159493 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab159493 has not yet been referenced specifically in any publications.
