Overview

  • Product name

    Recombinant Human SDPR protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDN SQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKL SKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLL RRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTV DLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQN IEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGE IAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYA LTSEEAERSDGDPVQPAVLQVHQTS
    • Amino acids

      1 to 425
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cavin 2
    • Cavin-2
    • Phosphatidylserine binding protein
    • Phosphatidylserine-binding protein
    • PS p68
    • PS-p68
    • Sdpr
    • SDPR_HUMAN
    • SDR
    • Serum deprivation response
    • Serum deprivation response protein
    • Serum deprivation-response protein
    see all
  • Function

    May play a role in targeting PRKCA to caveolae.
  • Tissue specificity

    Highly expressed in heart and lung, and expressed at lower levels in brain, kidney, liver, pancreas, placenta, and skeletal muscle.
  • Sequence similarities

    Belongs to the PTRF/SDPR family.
  • Post-translational
    modifications

    Phosphorylated on Ser residues.
  • Cellular localization

    Cytoplasm > cytosol. Membrane > caveola. Colocalizes with CAV1 to caveolae.
  • Information by UniProt

Images

  • ab160026 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up