Description

  • Product name

    Recombinant Human SEC10 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHI QELQIMDERIQRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELD EHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVF TNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEF TSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDA GILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDA EQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYI EVETGYLKSRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLG PSIDTHGETFLSQEVVVNLLQETKQAFERCHRLSDPSDLPRNAFRIFTIL VEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQANTIFHLFDKQF NDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIGQMKHI LAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVD TVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMV LHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRS ARLARHFS
    • Amino acids

      1 to 708
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as EXOC5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI447711
    • AI448003
    • DKFZp666H126
    • EXOC5
    • exocyst complex component 5
    • Exocyst complex component Sec10
    • Gm76
    • HSEC10
    • p71 component of rsec6/8 secretory complex
    • PRO1912
    • SEC10
    • SEC10 like 1
    • SEC10L1
    • SEC10P
    see all
  • Relevance

    EXOC5 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
  • Cellular localization

    Cytoplasmic

Images

  • ab161088 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up