Recombinant Human SEC14 like protein 2 (ab161678)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human SEC14 like protein 2 -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETIT IIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP -
Amino acids
101 to 199 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab161678 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Alpha tocopherol associated protein
- Alpha-tocopherol-associated protein
- C22orf6
see all -
Function
Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell. -
Tissue specificity
Widely expressed. Strong expression in liver, brain and prostate. -
Sequence similarities
Contains 1 CRAL-TRIO domain.
Contains 1 GOLD domain. -
Developmental stage
Low expression in fetal tissues. -
Cellular localization
Cytoplasm. Nucleus. Cytoplasmic in absence of alpha-tocopherol, and nuclear in presence of alpha-tocopherol. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab161678 has not yet been referenced specifically in any publications.