Overview

  • Product name

    Recombinant Human SEC22B protein (denatured)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLPLAASMQEDEQSGRDLQQYQSQAKQ LFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLE DLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSIN TELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNM RSTYA
    • Molecular weight

      23 kDa including tags
    • Amino acids

      14 to 194
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as SEC22L1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 12.01% Urea, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • ER-Golgi SNARE of 24 kDa
    • ERS 24
    • ERS-24
    • ERS24
    • SC22B_HUMAN
    • SEC22 vesicle trafficking protein homolog B
    • SEC22 vesicle trafficking protein like 1
    • SEC22 vesicle-trafficking protein homolog B
    • SEC22 vesicle-trafficking protein-like 1
    • Sec22b
    • SEC22L 1
    • Vesicle trafficking protein SEC22b
    • Vesicle-trafficking protein SEC22b
    see all
  • Function

    SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.
  • Sequence similarities

    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus, trans-Golgi network membrane. Melanosome. Concentrated most in the intermediate compartment/cis-Golgi network and the cis-Golgi cisternae 1 and 2. Greatly reduced in concentration at the trans end of the Golgi apparatus. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134537.

References

ab134537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up