Overview

  • Product name
    Recombinant Human SEC23IP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASL LLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFSQVSSSSDPFGNIGQSP LTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKAQPGAPPSSLM GINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQ LQQCQTPGPPAHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPG APSVQVPSPFLLQNQYEPVQPHWFYCKEVEYKQLWMPFSVFDSLNLEEIY NSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGD TDSRFIPYTEEFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIV QFQPSSVPDEWGTTQDGQTRPRVVKRGIDDNLDEIPDGEMPQVDHLVFVV HGIGPVCDLRFRSIIECVDDFRVVSLKLLRTHFKKSLDDGKVSRVEFLPV HWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDILFYNSPTYCQT IVEKVGMEINHLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLN LSKCPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENKEVLTLQ ETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFV EHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLP VGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIR GVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHK GRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQE ELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDY VLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH
    • Amino acids
      1 to 1000
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MSTP053
    • p125
    • P125A
    • Phospholipase
    • S23IP_HUMAN
    • Sec23 interacting protein p125
    • SEC23-interacting protein
    • SEC23IP
    see all
  • Function
    Plays a role in the organization of endoplasmic reticulum exit sites.
  • Tissue specificity
    Ubiquitously expressed with stronger levels detected in heart, liver and skeletal muscle.
  • Sequence similarities
    Belongs to the PA-PLA1 family.
    Contains 1 DDHD domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Cytoplasmic vesicle > COPII-coated vesicle membrane. Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab161346 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up