Description

  • Product name

    Recombinant Human SEC24A protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATP QLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL
    • Amino acids

      301 to 390
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • protein transport protein Sec24A
    • SEC24 family member A S cerevisiae
    • SEC24 related gene family member A
    • SEC24 related protein A
    • SEC24 S cerevisiae related gene family member A
    see all
  • Relevance

    The Sec23-Sec24 complex is a component of coat protein II coated vesicles that mediate protein transport from the endoplasmic reticulum in yeast. SEC24A is one of several mammalian proteins that show structural and functional homology to yeast Sec24.
  • Cellular localization

    Cytoplasm - perinuclear region Endoplasmic reticulum membrane Golgi apparatus membrane

Images

  • ab161162 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up