Description

  • Product name

    Recombinant Human Sec24C protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNVNQSVPPVPPFGQPQPIYPGYHQSSYGGQSGSTAPAIPYGAYNGPVPG YQQTPPQGMSRAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQ MQRLPGSQSFGSPLAPVGNQPPVLQPYGPPPTSAQVATQLSGMQISGAVA PAPPSSGLGFGPPTSLASASGSFPNSGLYGSYPQGQAPPLSQAQGHPGIQ TPQRSAPSQASSFTPPASGGPRLPSMTGPLLPGQSFGGPSVSQPNHVSSP PQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPY PAAPTFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVR GQVPPLVTTNFLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIK PLARLPPEEASPYVVDHGESGPLRCNRCKAYMCPFMQFIEGGRRFQCCFC SCINDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLATVDYCKNNKFPS PPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGAEESAIRVGFV TYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITS LLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAE APGKLKNRDDRKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFP NQYVDVATLSVVPQLTGGSVYKYASFQVENDQERFLSDLRRDVQKVVGFD AVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLN EESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINY MAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPEC MKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPR LLPLTKSPVESTTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQG VVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLT VVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS
    • Amino acids

      1 to 1094
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Protein transport protein Sec24C
    • SC 24C
    • SC24 C
    • SC24C
    • SC24C_HUMAN
    • Sec 24C
    • Sec24 C
    • SEC24 related gene family, member C (S. cerevisiae)
    • SEC24 related protein C
    • SEC24-related protein C
    • SEC24C
    see all
  • Function

    Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the SEC23/SEC24 family. SEC24 subfamily.
  • Cellular localization

    Cytoplasm. Cytoplasm > perinuclear region. Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160588 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up