Overview

  • Product name
    Recombinant Human Sec31A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDL SDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIIL YDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIW DLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRK NEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFAS SPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLS SSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSF GGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQ SQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDL GKKVNFWES
    • Amino acids
      1 to 509
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810024J13Rik
    • ABP125
    • ABP130
    • AU042160
    • DKFZp686N07171
    • HSPC275
    • HSPC334
    • KIAA0905
    • MGC90305
    • MGC93320
    • Protein transport protein Sec31A
    • SEC31 homolog A (S. cerevisiae)
    • SEC31 like 1
    • SEC31 like protein 1
    • SEC31 related protein A
    • SEC31L1
    • VAP1
    • Web1 like protein
    • Yeast Sec31p homolog
    see all
  • Relevance
    The protein encoded by this gene is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle; COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein By similarity. Note: Associates with membranes in a GTP-dependent manner

Images

  • ab161451 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up