Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSMPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRT TSAGTGGMWRFYTEDSPGLKVGP
    • Molecular weight
      9 kDa including tags
    • Amino acids
      1 to 70
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No.: NP_006799)

Specifications

Our Abpromise guarantee covers the use of ab174411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab174411 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • Protein translocation complex beta
    • Protein transport protein SEC61 beta subunit
    • Protein transport protein Sec61 subunit beta
    • SC61B_HUMAN
    • SEC 61B
    • SEC61 B
    • Sec61 beta subunit
    • Sec61 complex beta subunit
    • SEC61B
    see all
  • Function
    Necessary for protein translocation in the endoplasmic reticulum.
  • Sequence similarities
    Belongs to the SEC61-beta family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174411 (3  µg).

References

ab174411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up