Overview

  • Product name

    Recombinant Human SECP43 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFV EFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFV GDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQ KRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQY QNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDV TEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM
    • Amino acids

      1 to 287
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TRSPAP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110007F05Rik
    • AA387999
    • FLJ20503
    • PRO1902
    • RP4 669K10.4
    • SECp43
    • tRNA selenocysteine 1-associated protein 1
    • tRNA selenocysteine associated protein 1
    • tRNA selenocysteine-associated protein 1
    • Trnau1ap
    • TRSPAP1
    • TSAP1_HUMAN
    • WI1 2643G14.2
    see all
  • Information by UniProt

Images

  • ab162910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up