Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD PKSPQYCQVIHRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLI SSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSHCLASGEVMIS SLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMI STEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIP LEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKG WLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLF LGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLY ITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEP LGPALAHELRYPGGDCSSDIWI
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 472

Specifications

Our Abpromise guarantee covers the use of ab132817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Selenium Binding Protein 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 56 kDa selenium binding protein
    • 56 kDa selenium-binding protein
    • hSBP
    • LPSB
    • SBP
    • SBP1
    • SBP1_HUMAN
    • SBP56
    • Selenbp1
    • Selenbp2
    • Selenium Binding Protein 1
    • Selenium binding protein 2
    • Selenium binding protein1
    • Selenium-binding protein 1
    • SELNBP1
    • SP56
    see all
  • Function

    Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytoplasm. May be involved in intra-Golgi protein transport.
  • Tissue specificity

    Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two-fold up-regulated in brain and blood from schizophrenia patients.
  • Sequence similarities

    Belongs to the selenium-binding protein family.
  • Post-translational
    modifications

    Phosphorylated.
    The N-terminus is blocked.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol. Membrane. May associate with Golgi membrane. May associate with the membrane of autophagosomes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132817 stained with Coomassie Blue.

References

ab132817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up