Description

  • Product name

    Recombinant Human Selenophosphate synthetase 1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHF QEDEQFLGAVMPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDP
    • Amino acids

      1 to 96
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC4980
    • SELD
    • Selenide, water dikinase 1
    • Selenium donor protein 1
    • Selenophosphate synthetase 1
    • SEPHS1
    • SPS
    • SPS1
    see all
  • Relevance

    This protein encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co translationally incorporated into selenoproteins at in frame UGA codons.

Images

  • ab161483 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up